=============================================================
  Protein report format version 1.0 on 12-Dec-2019 20:09

  Contact: Leon Peshkin, Email:pesha@hms.harvard.edu
           Harvard Medical School
=============================================================

Input:

    Target Protein: "WUGSC:H_RG054D04.1" 

    This report is provided for Gene ID: Xelaev18003627m

======== Section 1:  Gene ID =========================

       ID: Xelaev18003627m, tr|O95036|O95036_HUMAN 

       Description: Similar to 60S ribosomal protein L7; similar to P18124 (PID:d133021)  

       Direct hit E-value: 4e-127, Reciprocal hit E-value: NaN 

======== Section 2:  Sequence ========================

     Gene Xelaev18003627m was found among sequences of the reference set 
     obtained from ftp://ftp.xenbase.org/pub/Genomics/JGI/Xenla9.1/1.8.3.2/ as 
     XL_9.1_v1.8.3.2.primaryTranscripts.pep.fa.gz	12295 KB  3/22/17 6:32:00 PM 

>Xelaev18003627m
MAGTEEKKLPSVPESLLKRRKQFAAAKLKRVKKILAAKKLRKTKRKVIFKRAESYYKEYRQIYRKEVRLARIARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRLVEPYIAWGYPNLKSVRQLIYKRGYLKIKNQRIPMTDNSLIEKYLGKKGLMCVEDLIHEIYTVGKNFKAANNFLWPFKLSSPRGGMNKKTTHFVEGGDAGNREDQINRMIRRMN


======== Section 3:  Relative Protein Change in Development =====================

     The raw per-protein data are given here and also attached as PNG plot 
     including 90% confidence intervals 

     Protein Symbol: WUGSC:H_RG054D04.1 
     Protein ID: Xelaev18003627m 
     Number of Peptides: 23 

Oocyte1	Oocyte2	Oocyte3	Oocyte4	Oocyte5	Oocyte6	Oocyte7	Oocyte8	Oocyte9	Oocyte10

High
0.115	0.102	0.114	0.110	0.120	0.118	0.117	0.115	0.114	0.112

Medium
0.103	0.090	0.102	0.099	0.108	0.106	0.105	0.103	0.103	0.101

Low
0.093	0.080	0.091	0.089	0.098	0.095	0.095	0.092	0.092	0.091


======== Section 4:  Peptide Data =====================

     A total of 23 peptide measurements were matched to this protein
     using Unique matches only, 4 of these peptides are unique by sequence. 

     A total of 0 razor peptide measurements were matched to this protein
     and 0 of these peptides are unique by sequence. 

     Note that a missed cleavage might give rise to some peptides.

     Protein: WUGSC:H_RG054D04.1 
     Protein ID: Xelaev18003627m 
     Number of Peptides: 23 

Sequence-Unique	Oocyte1	Oocyte2	Oocyte3	Oocyte4	Oocyte5	Oocyte6	Oocyte7	Oocyte8	Oocyte9	Oocyte10
K.GLMCVEDLIHEIYTVGK.N	225.9	207.8	238.3	248.5	221.6	233.6	241.7	232.5	237.6	204.8
Sequence-Unique	Oocyte1	Oocyte2	Oocyte3	Oocyte4	Oocyte5	Oocyte6	Oocyte7	Oocyte8	Oocyte9	Oocyte10
K.NQRIPMTDNSLIEK.Y	63.1	38.8	60.9	42.4	62.3	34.8	58.1	45.7	48.9	41.1
K.NQRIPMTDNSLIEK.Y	111.5	86.8	127.1	107.5	116.2	89.3	127.7	102.0	116.2	87.4
K.NQRIPMTDNSLIEK.Y	119.4	98.3	111.1	118.1	104.8	109.0	119.5	115.4	92.2	98.7
K.NQRIPMTDNSLIEK.Y	391.3	168.4	206.3	259.3	264.9	300.8	231.9	258.6	237.9	280.5
K.NQRIPMTDNSLIEK.Y	59.4	93.6	58.6	73.8	60.7	73.3	74.2	83.9	65.0	59.6
K.NQRIPMTDNSLIEK.Y	78.6	69.4	71.4	71.0	85.2	59.4	57.7	77.2	97.6	56.2
Sequence-Unique	Oocyte1	Oocyte2	Oocyte3	Oocyte4	Oocyte5	Oocyte6	Oocyte7	Oocyte8	Oocyte9	Oocyte10
K.RAESYYK.E	78.1	48.2	83.4	56.8	83.3	62.1	95.7	61.1	80.4	64.0
K.RAESYYK.E	61.5	64.4	50.4	81.2	51.2	77.5	50.2	78.2	53.9	61.3
K.RAESYYK.E	150.6	108.0	132.7	119.4	159.7	102.5	116.2	122.7	129.7	125.7
K.RAESYYK.E	77.9	95.6	76.1	78.7	98.6	84.3	81.9	42.3	70.2	63.5
Sequence-Unique	Oocyte1	Oocyte2	Oocyte3	Oocyte4	Oocyte5	Oocyte6	Oocyte7	Oocyte8	Oocyte9	Oocyte10
R.IPMTDNSLIEK.Y	87.8	75.1	108.1	72.5	87.5	70.9	93.4	79.1	87.8	65.8
R.IPMTDNSLIEK.Y	24.0	18.5	26.0	23.1	23.8	24.0	25.9	26.1	21.4	26.3
R.IPMTDNSLIEK.Y	26.0	27.7	30.9	30.9	33.2	29.1	28.6	25.2	31.7	32.2
R.IPMTDNSLIEK.Y	42.6	41.7	49.5	47.1	46.4	45.1	38.5	35.4	46.4	36.9
R.IPMTDNSLIEK.Y	65.7	67.8	68.1	66.7	62.1	54.8	44.2	55.4	57.4	49.5
R.IPMTDNSLIEK.Y	213.2	189.7	221.5	204.6	202.7	185.5	191.1	200.3	204.1	206.0
R.IPMTDNSLIEK.Y	87.9	80.3	83.2	93.1	90.6	85.4	81.9	88.1	96.3	82.7
R.IPMTDNSLIEK.Y	120.1	112.0	142.8	122.8	142.7	121.0	111.8	123.3	133.6	142.0
R.IPMTDNSLIEK.Y	40.7	46.0	40.3	47.5	38.4	35.4	36.1	44.1	34.5	25.1
R.IPMTDNSLIEK.Y	65.6	56.9	66.8	64.5	55.5	44.6	44.8	56.2	62.3	39.1
R.IPMTDNSLIEK.Y	50.8	48.0	46.2	50.6	57.1	44.1	43.6	50.9	49.1	46.0
R.IPMTDNSLIEK.Y	48.2	76.9	41.7	78.9	43.7	51.8	54.6	71.5	42.7	48.6
